Lineage for d1kqbc_ (1kqb C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204711Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2204712Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2204713Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2204762Protein Oxygen-insensitive NAD(P)H nitroreductase [55476] (3 species)
  7. 2204763Species Enterobacter cloacae [TaxId:550] [55477] (6 PDB entries)
  8. 2204770Domain d1kqbc_: 1kqb C: [68800]
    complexed with bez, fmn

Details for d1kqbc_

PDB Entry: 1kqb (more details), 1.8 Å

PDB Description: structure of nitroreductase from e. cloacae complex with inhibitor benzoate
PDB Compounds: (C:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d1kqbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqbc_ d.90.1.1 (C:) Oxygen-insensitive NAD(P)H nitroreductase {Enterobacter cloacae [TaxId: 550]}
diisvalkrhstkafdaskkltaeeaekiktllqyspsstnsqpwhfivasteegkarva
ksaagtyvfnerkmldashvvvfcaktamddawlervvdqeeadgrfntpeakaanhkgr
tyfadmhrvdlkdddqwmakqvylnvgnfllgvgamgldavpiegfdaaildeefglkek
gftslvvvpvghhsvedfnatlpksrlplstivtec

SCOPe Domain Coordinates for d1kqbc_:

Click to download the PDB-style file with coordinates for d1kqbc_.
(The format of our PDB-style files is described here.)

Timeline for d1kqbc_: