Lineage for d1kpia_ (1kpi A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893430Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 2893443Protein CmaA2 [116723] (1 species)
  7. 2893444Species Mycobacterium tuberculosis [TaxId:1773] [116724] (1 PDB entry)
  8. 2893445Domain d1kpia_: 1kpi A: [68743]
    complexed with 10a, co3, sah, so4

Details for d1kpia_

PDB Entry: 1kpi (more details), 2.65 Å

PDB Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA2 complexed with SAH and DDDMAB
PDB Compounds: (A:) Cyclopropane-fatty-acyl-phospholipid synthase 2

SCOPe Domain Sequences for d1kpia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}
qlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldklnle
pgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgw
eefdepvdrivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkee
aqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkveryhriganyvptl
nawadalqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftlvk

SCOPe Domain Coordinates for d1kpia_:

Click to download the PDB-style file with coordinates for d1kpia_.
(The format of our PDB-style files is described here.)

Timeline for d1kpia_: