| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein) |
| Protein mRNA export factor tap [54955] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries) |
| Domain d1kooa2: 1koo A:105-200 [68727] Other proteins in same PDB: d1kooa1, d1koob_, d1kooc1, d1kood_ mutant |
PDB Entry: 1koo (more details), 3.8 Å
SCOPe Domain Sequences for d1kooa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kooa2 d.58.7.2 (A:105-200) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
rggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffve
dastasalkavnykildrenrrisiiinssapphti
Timeline for d1kooa2:
View in 3DDomains from other chains: (mouse over for more information) d1koob_, d1kooc1, d1kooc2, d1kood_ |