Lineage for d1koob_ (1koo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098611Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2098659Family c.10.2.3: mRNA export factor tap [52065] (2 protein domains)
  6. 2098660Protein mRNA export factor tap [52066] (1 species)
  7. 2098661Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)
  8. 2098667Domain d1koob_: 1koo B: [68728]
    Other proteins in same PDB: d1kooa2, d1kooc2
    mutant

Details for d1koob_

PDB Entry: 1koo (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor
PDB Compounds: (B:) tip associating protein

SCOPe Domain Sequences for d1koob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koob_ c.10.2.3 (B:) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
elkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlriiee
nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
dgnslcdtfrdqstyisairerfpkllrldghelpppiafdveap

SCOPe Domain Coordinates for d1koob_:

Click to download the PDB-style file with coordinates for d1koob_.
(The format of our PDB-style files is described here.)

Timeline for d1koob_: