Lineage for d1knvb_ (1knv B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136358Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins)
    automatically mapped to Pfam PF07832
  6. 2136359Protein Restriction endonuclease Bse634I [69523] (1 species)
  7. 2136360Species Bacillus stearothermophilus [TaxId:1422] [69524] (4 PDB entries)
  8. 2136362Domain d1knvb_: 1knv B: [68708]
    complexed with act, cl

Details for d1knvb_

PDB Entry: 1knv (more details), 2.17 Å

PDB Description: Bse634I restriction endonuclease
PDB Compounds: (B:) Bse634I restriction endonuclease

SCOPe Domain Sequences for d1knvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knvb_ c.52.1.7 (B:) Restriction endonuclease Bse634I {Bacillus stearothermophilus [TaxId: 1422]}
tnltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakg
laiptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetre
klhqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdi
egkckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmrywnpkaefkyygasse
pvskadddalqtaathtivnvnstperavddifsltsfedidkmldqiikk

SCOPe Domain Coordinates for d1knvb_:

Click to download the PDB-style file with coordinates for d1knvb_.
(The format of our PDB-style files is described here.)

Timeline for d1knvb_: