SCOPe 2.04: Domain d1kkec1: 1kke C:250-312

Lineage for d1kkec1 (1kke C:250-312)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.83: Triple beta-spiral [51224] (1 superfamily)
   trimer formed by the interlocking beta-hairpin repeat units

4. Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families)

5. Family b.83.1.2: Reovirus attachment protein sigma 1 [69356] (1 protein)

6. Protein Reovirus attachment protein sigma 1 [69357] (1 species)

7. Species Reovirus [TaxId:10891] [69358] (1 PDB entry)

8. Domain d1kkec1: 1kke C:250-312 [68673]
   Other proteins in same PDB: d1kkea2, d1kkeb2, d1kkec2

Details for d1kkec1

PDB Entry: 1kke, 2.6 Å

PDB Description: Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer

PDB Compounds: (C:) sigma 1 protein

SCOPe Domain Sequences for d1kkec1:

Sequence; same for both SEQRES and ATOM records:

>d1kkec1 b.83.1.2 (C:250-312) Reovirus attachment protein sigma 1 {Reovirus [TaxId: 10891]}
eqsyvasavtplrlnsstkvldmlidsstleinssgqltvrstspnlrypiadvsggigm
spn

Timeline for d1kkec1:

• d1kkec1 first appeared in SCOP 1.59
  
• d1kkec1 appears in SCOPe 2.03
  
• d1kkec1 appears in SCOPe 2.05
  
• d1kkec1 appears in the current release, SCOPe 2.08