SCOPe 2.08: Domain d1khhb_: 1khh B:

Lineage for d1khhb_ (1khh B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein)

6. Protein Guanidinoacetate methyltransferase [69551] (2 species)
   a template structure of protein arginine methyltransferase

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69552] (5 PDB entries)
   Uniprot P10868

8. Domain d1khhb_: 1khh B: [68616]
   complexed with sah

Details for d1khhb_

PDB Entry: 1khh, 2.5 Å

PDB Description: crystal structure of guanidinoacetate methyltransferase from rat liver: a template structure of protein arginine methyltransferase

PDB Compounds: (B:) Guanidinoacetate methyltransferase

SCOPe Domain Sequences for d1khhb_:

Sequence; same for both SEQRES and ATOM records:

>d1khhb_ c.66.1.16 (B:) Guanidinoacetate methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rwetpymhslaaaaasrggrvlevgfgmaiaasrvqqapikehwiiecndgvfqrlqnwa
lkqphkvvplkglweevaptlpdghfdgilydtyplseetwhthqfnfikthafrllkpg
giltycnltswgelmkskytditamfeetqvpalleagfqrenictevmalvppadcryy
afpqmitplvtkh

Timeline for d1khhb_:

• d1khhb_ first appeared in SCOP 1.59
  
• d1khhb_ appears in SCOPe 2.07