Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein) |
Protein Guanidinoacetate methyltransferase [69551] (2 species) a template structure of protein arginine methyltransferase |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [69552] (5 PDB entries) Uniprot P10868 |
Domain d1khhb_: 1khh B: [68616] complexed with sah |
PDB Entry: 1khh (more details), 2.5 Å
SCOPe Domain Sequences for d1khhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khhb_ c.66.1.16 (B:) Guanidinoacetate methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]} rwetpymhslaaaaasrggrvlevgfgmaiaasrvqqapikehwiiecndgvfqrlqnwa lkqphkvvplkglweevaptlpdghfdgilydtyplseetwhthqfnfikthafrllkpg giltycnltswgelmkskytditamfeetqvpalleagfqrenictevmalvppadcryy afpqmitplvtkh
Timeline for d1khhb_: