SCOPe 2.08: Domain d1kfia3: 1kfi A:324-443

Lineage for d1kfia3 (1kfi A:324-443)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)

6. Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin, middle and C-terminal domain [419005] (1 species)
7. Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [419477] (2 PDB entries)

8. Domain d1kfia3: 1kfi A:324-443 [68557]
   Other proteins in same PDB: d1kfia1, d1kfia4, d1kfib1, d1kfib4
   complexed with so4, zn

Details for d1kfia3

PDB Entry: 1kfi, 2.4 Å

PDB Description: Crystal Structure of the Exocytosis-Sensitive Phosphoprotein, pp63/Parafusin (phosphoglucomutase) from Paramecium

PDB Compounds: (A:) phosphoglucomutase 1

SCOPe Domain Sequences for d1kfia3:

Sequence; same for both SEQRES and ATOM records:

>d1kfia3 c.84.1.1 (A:324-443) Exocytosis-sensitive phosphoprotein, pp63/parafusin, middle and C-terminal domain {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
tpsdslaviaananlifkngllgaarsmptsgaldkvaakngiklfetptgwkffgnlmd
aglinlcgeesfgtgsnhirekdgiwavlawltilahknkntdhfvtveeivtqywqqfg

Timeline for d1kfia3:

• d1kfia3 first appeared in SCOP 1.59
  
• d1kfia3 appears in SCOPe 2.07