![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins) |
![]() | Domain d1kfib3: 1kfi B:324-443 [68561] Other proteins in same PDB: d1kfia1, d1kfia4, d1kfib1, d1kfib4 complexed with so4, zn |
PDB Entry: 1kfi (more details), 2.4 Å
SCOPe Domain Sequences for d1kfib3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfib3 c.84.1.1 (B:324-443) Exocytosis-sensitive phosphoprotein, pp63/parafusin, middle and C-terminal domain {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} tpsdslaviaananlifkngllgaarsmptsgaldkvaakngiklfetptgwkffgnlmd aglinlcgeesfgtgsnhirekdgiwavlawltilahknkntdhfvtveeivtqywqqfg
Timeline for d1kfib3:
![]() Domains from other chains: (mouse over for more information) d1kfia1, d1kfia2, d1kfia3, d1kfia4 |