Lineage for d1keeg6 (1kee G:677-935)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928459Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 1928520Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 1928521Species Escherichia coli [TaxId:562] [56077] (10 PDB entries)
    Uniprot P00968
  8. 1928569Domain d1keeg6: 1kee G:677-935 [68521]
    Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keeb1, d1keeb2, d1keec1, d1keec2, d1keec3, d1keec4, d1keed1, d1keed2, d1keee1, d1keee2, d1keee3, d1keee4, d1keef1, d1keef2, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeh1, d1keeh2
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1keeg6

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin
PDB Compounds: (G:) Carbamoyl-phosphate synthetase large chain

SCOPe Domain Sequences for d1keeg6:

Sequence, based on SEQRES records: (download)

>d1keeg6 d.142.1.2 (G:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr
yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl
paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska
tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge
vmgvgrtfaeafakaqlgs

Sequence, based on observed residues (ATOM records): (download)

>d1keeg6 d.142.1.2 (G:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpameivydeadlrryfqtavl
ldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmrq
qvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvmag
kslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafaka
qlgs

SCOPe Domain Coordinates for d1keeg6:

Click to download the PDB-style file with coordinates for d1keeg6.
(The format of our PDB-style files is described here.)

Timeline for d1keeg6: