Lineage for d1ke1a_ (1ke1 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 990724Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 990725Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 990967Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 proteins)
    elaborated with additional structures
  6. 990968Protein Serine-carboxyl proteinase, SCP [52765] (3 species)
  7. 990986Species Pseudomonas sp., sedolisin [TaxId:306] [52766] (9 PDB entries)
  8. 990994Domain d1ke1a_: 1ke1 A: [68489]
    complexed with ca

Details for d1ke1a_

PDB Entry: 1ke1 (more details), 1.8 Å

PDB Description: pseudomonas serine-carboxyl proteinase complexed with the inhibitor pseudotyrostatin (this enzyme renamed "sedolisin" in 2003)
PDB Compounds: (A:) serine-carboxyl proteinase

SCOPe Domain Sequences for d1ke1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ke1a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]}
gtakghnptefptiydassaptaanttvgiitiggvsqtlqdlqqftsanglasvntqti
qtgssngdysddqqgqgewdldsqsivgsaggavqqllfymadqsasgntgltqafnqav
sdnvakvinvslgwceadanadgtlqaedrifataaaqgqtfsvssgdegvyecnnrgyp
dgstysvswpasspnviavggttlyttsagaysnetvwnegldsngklwatgggysvyes
kpswqsvvsgtpgrrllpdisfdaaqgtgaliynygqlqqiggtslaspifvglwarlqs
ansnslgfpaasfysaisstpslvhdvksgnngyggygynagtgwdyptgwgsldiakls
ayirsngf

SCOPe Domain Coordinates for d1ke1a_:

Click to download the PDB-style file with coordinates for d1ke1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ke1a_: