Lineage for d1kdza_ (1kdz A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) Fold c.41: Subtilisin-like [52742] (1 superfamily) Superfamily c.41.1: Subtilisin-like [52743] (2 families) 
Family c.41.1.2: Serine-carboxyl proteinase PSCP [52764] (1 protein) Protein Serine-carboxyl proteinase PSCP [52765] (2 species) Species Pseudomonas sp. [TaxId:306] [52766] (8 PDB entries) 
Domain d1kdza_: 1kdz A: [68488]
Details for d1kdza_
PDB Entry: 1kdz (more details), 1.4 Å
PDB Description: pseudomonas serine-carboxyl proteinase complexed with the inhibitor tyrostatin (this enzyme renamed "sedolisin" in 2003)
SCOP Domain Sequences for d1kdza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdza_ c.41.1.2 (A:) Serine-carboxyl proteinase PSCP {Pseudomonas sp.}
takghnptefptiydassaptaanttvgiitiggvsqtlqdlqqftsanglasvntqtiq
tgssngdysddqqgqgewdldsqsivgsaggavqqllfymadqsasgntgltqafnqavs
dnvakvinvslgwceadanadgtlqaedrifataaaqgqtfsvssgdegvyecnnrgypd
gstysvswpasspnviavggttlyttsagaysnetvwnegldsngklwatgggysvyesk
pswqsvvsgtpgrrllpdisfdaaqgtgaliynygqlqqiggtslaspifvglwarlqsa
nsnslgfpaasfysaisstpslvhdvksgnngyggygynagtgwdyptgwgsldiaklsa
yirsngf
SCOP Domain Coordinates for d1kdza_:
Click to download the PDB-style file with coordinates for d1kdza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kdza_:
- d1kdza_ first appeared in SCOP 1.59
- d1kdza_ appears in SCOP 1.63
- d1kdza_ appears in the current release, SCOPe 2.08
View in 3D