Lineage for d1k9ya_ (1k9y A:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266544Fold e.7: Sugar phosphatases [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 266545Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 266546Family e.7.1.1: Sugar phosphatases [56656] (6 proteins)
  6. 266547Protein 3';5'-adenosine bisphosphatase, PAP phosphatase [56669] (2 species)
  7. 266548Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69878] (4 PDB entries)
  8. 266552Domain d1k9ya_: 1k9y A: [68366]
    complexed with amp, bme, mg, po4

Details for d1k9ya_

PDB Entry: 1k9y (more details), 1.9 Å

PDB Description: The PAPase Hal2p complexed with magnesium ions and reaction products: AMP and inorganic phosphate

SCOP Domain Sequences for d1k9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ya_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae)}
alerellvatqavrkaslltkriqsevishkdsttitkndnspvttgdyaaqtiiinaik
snfpddkvvgeesssglsdafvsgilneikandevynknykkddflftndqfplksledv
rqiidfgnyeggrkgrfwcldpidgtkgflrgeqfavclalivdgvvqlgcigcpnlvls
sygaqdlkghesfgyifravrglgafyspssdaeswtkihvrhlkdtkdmitlegvekgh
sshdeqtaiknklniskslhldsqakycllalgladvylrlpiklsyqekiwdhaagnvi
vheaggihtdamedvpldfgngrtlatkgviassgprelhdlvvstscdviqsr

SCOP Domain Coordinates for d1k9ya_:

Click to download the PDB-style file with coordinates for d1k9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ya_: