Lineage for d1k9qa_ (1k9q A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961395Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 961396Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 961397Family b.72.1.1: WW domain [51046] (12 proteins)
  6. 961460Protein Yap65 ww domain [69330] (1 species)
  7. 961461Species Human (Homo sapiens) [TaxId:9606] [69331] (4 PDB entries)
  8. 961464Domain d1k9qa_: 1k9q A: [68357]
    complexed to n-(n-octyl)-gpppy-nh2
    complexed with oct

Details for d1k9qa_

PDB Entry: 1k9q (more details)

PDB Description: yap65 ww domain complexed to n-(n-octyl)-gpppy-nh2
PDB Compounds: (A:) 65 kda yes-associated protein

SCOPe Domain Sequences for d1k9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9qa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]}
feipddvplpagwemaktssgqryflnhidqtttwqdprk

SCOPe Domain Coordinates for d1k9qa_:

Click to download the PDB-style file with coordinates for d1k9qa_.
(The format of our PDB-style files is described here.)

Timeline for d1k9qa_: