Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (12 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (80 PDB entries) Uniprot P02593 |
Domain d1k93d_: 1k93 D: [68330] Other proteins in same PDB: d1k93a_, d1k93b_, d1k93c_ complexed with ca, so4 |
PDB Entry: 1k93 (more details), 2.95 Å
SCOPe Domain Sequences for d1k93d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k93d_ a.39.1.5 (D:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem ireadidgdgqvnyeefvqmmta
Timeline for d1k93d_: