Lineage for d1k92a2 (1k92 A:189-444)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238889Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2238890Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2238891Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 proteins)
  6. 2238892Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 2238893Species Escherichia coli [TaxId:562] [69867] (4 PDB entries)
  8. 2238894Domain d1k92a2: 1k92 A:189-444 [68326]
    Other proteins in same PDB: d1k92a1
    complexed with gol, so4

Details for d1k92a2

PDB Entry: 1k92 (more details), 1.6 Å

PDB Description: Crystal Structure of Uncomplexed E. coli Argininosuccinate Synthetase
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d1k92a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k92a2 d.210.1.1 (A:189-444) Argininosuccinate synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
aystdsnmlgatheakdleylnssvkivnpimgvkfwdesvkipaeevtvrfeqghpval
ngktfsddvemmleanriggrhglgmsdqienriieaksrgiyeapgmallhiayerllt
gihnedtieqyhahgrqlgrllyqgrwfdsqalmlrdslqrwvasqitgevtlelrrgnd
ysilntvsenltykperltmekgdsvfspddrigqltmrnlditdtreklfgyaktglls
ssaasgvpqvenlenk

SCOPe Domain Coordinates for d1k92a2:

Click to download the PDB-style file with coordinates for d1k92a2.
(The format of our PDB-style files is described here.)

Timeline for d1k92a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k92a1