Lineage for d1k8kb1 (1k8k B:154-343)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605234Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 1605235Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 1605236Domain d1k8kb1: 1k8k B:154-343 [68307]
    Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kf_, d1k8kg_
    the second half only

Details for d1k8kb1

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex
PDB Compounds: (B:) actin-like protein 2

SCOPe Domain Sequences for d1k8kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv
rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv
egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd
veklskfkir

SCOPe Domain Coordinates for d1k8kb1:

Click to download the PDB-style file with coordinates for d1k8kb1.
(The format of our PDB-style files is described here.)

Timeline for d1k8kb1: