Lineage for d1k8ib2 (1k8i B:1-94)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131977Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species)
  7. 132030Species Mouse (Mus musculus), H2-DM [TaxId:10090] [69679] (1 PDB entry)
  8. 132032Domain d1k8ib2: 1k8i B:1-94 [68304]
    Other proteins in same PDB: d1k8ia1, d1k8ib1

Details for d1k8ib2

PDB Entry: 1k8i (more details), 3.1 Å

PDB Description: crystal structure of mouse h2-dm

SCOP Domain Sequences for d1k8ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ib2 d.19.1.1 (B:1-94) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), H2-DM}
gfvahvestcvlndagtpqdftycvsfnkdllacwdpdvgkivpcefgvlsrlaeiisni
lneqeslihrlqnglqdcathtqpfwdvlthrtr

SCOP Domain Coordinates for d1k8ib2:

Click to download the PDB-style file with coordinates for d1k8ib2.
(The format of our PDB-style files is described here.)

Timeline for d1k8ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k8ib1