Lineage for d1k8ib1 (1k8i B:95-190)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784902Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 784969Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88627] (1 PDB entry)
    probably orthologous to the human HLA-DM
  8. 784970Domain d1k8ib1: 1k8i B:95-190 [68303]
    Other proteins in same PDB: d1k8ia1, d1k8ia2, d1k8ib2
    complexed with nag

Details for d1k8ib1

PDB Entry: 1k8i (more details), 3.1 Å

PDB Description: crystal structure of mouse h2-dm
PDB Compounds: (B:) MHC class II H2-M beta 2 chain

SCOP Domain Sequences for d1k8ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ib1 b.1.1.2 (B:95-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]}
apsvrvaqttpfntrepvmlacyvwgfypadvtitwmkngqlvpshsnkektaqpngdwt
yqtvsylaltpsygdvytcvvqhsgtsepirgdwtp

SCOP Domain Coordinates for d1k8ib1:

Click to download the PDB-style file with coordinates for d1k8ib1.
(The format of our PDB-style files is described here.)

Timeline for d1k8ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k8ib2