SCOPe 2.08: Domain d1k8ib1: 1k8i B:95-190

Lineage for d1k8ib1 (1k8i B:95-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), H2-DM [TaxId:10090] [88627] (1 PDB entry)
   probably orthologous to the human HLA-DM

8. Domain d1k8ib1: 1k8i B:95-190 [68303]
   Other proteins in same PDB: d1k8ia1, d1k8ia2, d1k8ib2
   complexed with nag

Details for d1k8ib1

PDB Entry: 1k8i, 3.1 Å

PDB Description: crystal structure of mouse h2-dm

PDB Compounds: (B:) MHC class II H2-M beta 2 chain

SCOPe Domain Sequences for d1k8ib1:

Sequence; same for both SEQRES and ATOM records:

>d1k8ib1 b.1.1.2 (B:95-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), H2-DM [TaxId: 10090]}
apsvrvaqttpfntrepvmlacyvwgfypadvtitwmkngqlvpshsnkektaqpngdwt
yqtvsylaltpsygdvytcvvqhsgtsepirgdwtp

Timeline for d1k8ib1:

• d1k8ib1 first appeared in SCOP 1.59
  
• d1k8ib1 appears in SCOPe 2.07