Lineage for d1k7aa_ (1k7a A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) 
Family a.4.5.21: ets domain [46859] (6 proteins) 
Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [46863] (5 PDB entries) 
Domain d1k7aa_: 1k7a A: [68264]
Details for d1k7aa_
PDB Entry: 1k7a (more details), 2.8 Å
PDB Description: Ets-1(331-440)+GGAG duplex
SCOP Domain Sequences for d1k7aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k7aa_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk
SCOP Domain Coordinates for d1k7aa_:
Click to download the PDB-style file with coordinates for d1k7aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k7aa_:
- d1k7aa_ is new in SCOP 1.59
- d1k7aa_ appears in SCOP 1.61
- d1k7aa_ appears in the current release, SCOPe 2.08
View in 3D
