Lineage for d1k78b_ (1k78 B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) 
Family a.4.5.21: ets domain [46859] (6 proteins) 
Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [46863] (5 PDB entries) 
Domain d1k78b_: 1k78 B: [68257]
Other proteins in same PDB: d1k78a1, d1k78a2, d1k78e1, d1k78e2, d1k78i1
Details for d1k78b_
PDB Entry: 1k78 (more details), 2.25 Å
PDB Description: Pax5(1-149)+Ets-1(331-440)+DNA
SCOP Domain Sequences for d1k78b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k78b_ a.4.5.21 (B:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk
SCOP Domain Coordinates for d1k78b_:
Click to download the PDB-style file with coordinates for d1k78b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k78b_:
- d1k78b_ first appeared in SCOP 1.59
- d1k78b_ appears in SCOP 1.63
- d1k78b_ appears in the current release, SCOPe 2.08
View in 3D
