SCOP 1.73: Domain d1k6vb_: 1k6v B:

Lineage for d1k6vb_ (1k6v B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries)

8. Domain d1k6vb_: 1k6v B: [68235]
   complexed with act, xn2; mutant

Details for d1k6vb_

PDB Entry: 1k6v, 2 Å

PDB Description: lack of synergy for inhibitors targeting a multi-drug resistant hiv-1 protease

PDB Compounds: (B:) Pol polyprotein

SCOP Domain Sequences for d1k6vb_:

Sequence; same for both SEQRES and ATOM records:

>d1k6vb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d1k6vb_:

• d1k6vb_ first appeared in SCOP 1.59
  
• d1k6vb_ appears in SCOP 1.71
  
• d1k6vb_ appears in SCOP 1.75
  
• d1k6vb_ appears in the current release, SCOPe 2.08