SCOP 1.59: Domain d1k6cb_: 1k6c B:

Lineage for d1k6cb_ (1k6c B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)

8. Domain d1k6cb_: 1k6c B: [68216]

Details for d1k6cb_

PDB Entry: 1k6c, 2.2 Å

PDB Description: lack of synergy for inhibitors targeting a multi-drug resistant hiv-1 protease

SCOP Domain Sequences for d1k6cb_:

Sequence; same for both SEQRES and ATOM records:

>d1k6cb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d1k6cb_:

• d1k6cb_ is new in SCOP 1.59
  
• d1k6cb_ appears in SCOP 1.61
  
• d1k6cb_ appears in the current release, SCOPe 2.08