| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species) |
| Species Escherichia coli [TaxId:562] [69411] (11 PDB entries) Uniprot P45568 |
| Domain d1k5hb2: 1k5h B:1-125,B:275-300 [68196] Other proteins in same PDB: d1k5ha1, d1k5ha3, d1k5hb1, d1k5hb3, d1k5hc1, d1k5hc3 |
PDB Entry: 1k5h (more details), 2.5 Å
SCOPe Domain Sequences for d1k5hb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5hb2 c.2.1.3 (B:1-125,B:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc
Timeline for d1k5hb2: