Lineage for d1k5gi_ (1k5g I:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111497Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 2111527Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein)
    this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain
  6. 2111528Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species)
    GTPase-activating protein for SpI1, ortologue of Ran
    duplication: consists of 11 repeats
  7. 2111529Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (4 PDB entries)
  8. 2111540Domain d1k5gi_: 1k5g I: [68188]
    Other proteins in same PDB: d1k5ga_, d1k5gb_, d1k5gd_, d1k5ge_, d1k5gg_, d1k5gh_, d1k5gj_, d1k5gk_
    complexed with af3, gdp, mg

Details for d1k5gi_

PDB Entry: 1k5g (more details), 3.1 Å

PDB Description: Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex
PDB Compounds: (I:) Ran GTPase activating protein 1

SCOPe Domain Sequences for d1k5gi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5gi_ c.10.1.2 (I:) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee

SCOPe Domain Coordinates for d1k5gi_:

Click to download the PDB-style file with coordinates for d1k5gi_.
(The format of our PDB-style files is described here.)

Timeline for d1k5gi_: