Lineage for d1k5gg_ (1k5g G:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179633Protein Ran [52609] (2 species)
  7. 179647Species Human (Homo sapiens) [TaxId:9606] [52611] (6 PDB entries)
  8. 179660Domain d1k5gg_: 1k5g G: [68186]
    Other proteins in same PDB: d1k5gb_, d1k5gc_, d1k5ge_, d1k5gf_, d1k5gh_, d1k5gi_, d1k5gk_, d1k5gl_

Details for d1k5gg_

PDB Entry: 1k5g (more details), 3.1 Å

PDB Description: Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex

SCOP Domain Sequences for d1k5gg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5gg_ c.37.1.8 (G:) Ran {Human (Homo sapiens)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpded

SCOP Domain Coordinates for d1k5gg_:

Click to download the PDB-style file with coordinates for d1k5gg_.
(The format of our PDB-style files is described here.)

Timeline for d1k5gg_: