Lineage for d1k5db_ (1k5d B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412966Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 2412974Protein Ran-binding protein 1, Ranbp1 [69292] (1 species)
  7. 2412975Species Human (Homo sapiens) [TaxId:9606] [69293] (2 PDB entries)
  8. 2412976Domain d1k5db_: 1k5d B: [68169]
    Other proteins in same PDB: d1k5da_, d1k5dc_, d1k5dd_, d1k5df_, d1k5dg_, d1k5di_, d1k5dj_, d1k5dl_
    complexed with gnp, mg

Details for d1k5db_

PDB Entry: 1k5d (more details), 2.7 Å

PDB Description: Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex
PDB Compounds: (B:) Ran-specific GTPase-activating protein

SCOPe Domain Sequences for d1k5db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5db_ b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]}
nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
flnaenaqkfktkfeecrkeieerek

SCOPe Domain Coordinates for d1k5db_:

Click to download the PDB-style file with coordinates for d1k5db_.
(The format of our PDB-style files is described here.)

Timeline for d1k5db_: