Lineage for d1k56a_ (1k56 A:)
- Root: SCOP 1.61
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein Class D beta-lactamase [56622] (2 species) Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (10 PDB entries) 
Domain d1k56a_: 1k56 A: [68160]
Details for d1k56a_
PDB Entry: 1k56 (more details), 1.7 Å
PDB Description: OXA 10 class D beta-lactamase at pH 6.5
SCOP Domain Sequences for d1k56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k56a_ e.3.1.1 (A:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10}
itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
gii
SCOP Domain Coordinates for d1k56a_:
Click to download the PDB-style file with coordinates for d1k56a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k56a_:
- d1k56a_ first appeared in SCOP 1.59
- d1k56a_ appears in SCOP 1.63
- d1k56a_ appears in the current release, SCOPe 2.08
View in 3D
