Lineage for d1k53b1 (1k53 B:2-64)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934644Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 2934645Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 2934659Domain d1k53b1: 1k53 B:2-64 [68151]
    Other proteins in same PDB: d1k53a2, d1k53b2
    b1 domain
    complexed with zn; mutant

Details for d1k53b1

PDB Entry: 1k53 (more details), 2.1 Å

PDB Description: monomeric protein l b1 domain with a g15a mutation
PDB Compounds: (B:) protein l

SCOPe Domain Sequences for d1k53b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k53b1 d.15.7.1 (B:2-64) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
eevtikanlifanastqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
fag

SCOPe Domain Coordinates for d1k53b1:

Click to download the PDB-style file with coordinates for d1k53b1.
(The format of our PDB-style files is described here.)

Timeline for d1k53b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k53b2