PDB entry 1k53

View 1k53 on RCSB PDB site
Description: Monomeric Protein L B1 Domain with a G15A Mutation
Class: protein binding
Keywords: Protein L B1 domain, strained beta-hairpin turn, positive phi angles, domain swapping, amyloid formation, PROTEIN BINDING
Deposited on 2001-10-09, released 2001-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • expression tag (0-8)
      • engineered (22)
      • engineered (54)
    Domains in SCOPe 2.08: d1k53a1, d1k53a2
  • Chain 'B':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • expression tag (0-8)
      • engineered (22)
      • engineered (54)
    Domains in SCOPe 2.08: d1k53b1, d1k53b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k53A (A:)
    mhhhhhhameevtikanlifanastqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k53B (B:)
    mhhhhhhameevtikanlifanastqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag