Lineage for d1k4fa_ (1k4f A:)
- Root: SCOP 1.61
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein Class D beta-lactamase [56622] (2 species) Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (10 PDB entries) 
Domain d1k4fa_: 1k4f A: [68138]
Details for d1k4fa_
PDB Entry: 1k4f (more details), 1.6 Å
PDB Description: crystal structure of the class d beta-lactamase oxa-10 at 1.6 a resolution
SCOP Domain Sequences for d1k4fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4fa_ e.3.1.1 (A:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
egii
SCOP Domain Coordinates for d1k4fa_:
Click to download the PDB-style file with coordinates for d1k4fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k4fa_:
- d1k4fa_ first appeared in SCOP 1.59
- d1k4fa_ appears in SCOP 1.63
- d1k4fa_ appears in the current release, SCOPe 2.08
View in 3D
