Lineage for d1k3na_ (1k3n A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117952Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1117953Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1117987Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 1118015Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)
  7. 1118016Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)
  8. 1118025Domain d1k3na_: 1k3n A: [68118]
    complex with a rad9-derived phosphothreonine peptide

Details for d1k3na_

PDB Entry: 1k3n (more details)

PDB Description: nmr structure of the fha1 domain of rad53 in complex with a rad9- derived phosphothreonine (at t155) peptide
PDB Compounds: (A:) protein kinase spk1

SCOPe Domain Sequences for d1k3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3na_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir

SCOPe Domain Coordinates for d1k3na_:

Click to download the PDB-style file with coordinates for d1k3na_.
(The format of our PDB-style files is described here.)

Timeline for d1k3na_: