Class b: All beta proteins [48724] (178 folds) |
Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) has a circularly permuted immunoglobulin-fold topology with extra strand |
Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins) automatically mapped to Pfam PF03145 |
Protein SIAH, seven in absentia homolog [69199] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [69200] (2 PDB entries) |
Domain d1k2fb_: 1k2f B: [68055] complexed with bme, zn |
PDB Entry: 1k2f (more details), 2.6 Å
SCOPe Domain Sequences for d1k2fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2fb_ b.8.1.2 (B:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} svlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhqh ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn lginvtismc
Timeline for d1k2fb_: