Lineage for d1k25c2 (1k25 C:2693-2750)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536656Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 2536657Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) (S)
    duplication: consists of 2 subdomains of this fold
  5. 2536658Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 2536659Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 2536660Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 2536692Domain d1k25c2: 1k25 C:2693-2750 [68042]
    Other proteins in same PDB: d1k25a3, d1k25a4, d1k25b3, d1k25b4, d1k25c3, d1k25c4, d1k25d3, d1k25d4

Details for d1k25c2

PDB Entry: 1k25 (more details), 3.2 Å

PDB Description: pbp2x from a highly penicillin-resistant streptococcus pneumoniae clinical isolate
PDB Compounds: (C:) low-affinity PENICILLIN-BINDING PROTEIN 2X

SCOPe Domain Sequences for d1k25c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k25c2 d.11.1.1 (C:2693-2750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
veeipdmygwkketaetfakwldielefegsgsvvqkqdvrtntaiknikkikltlgd

SCOPe Domain Coordinates for d1k25c2:

Click to download the PDB-style file with coordinates for d1k25c2.
(The format of our PDB-style files is described here.)

Timeline for d1k25c2: