Lineage for d1k1eh_ (1k1e H:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404418Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 404419Superfamily c.108.1: HAD-like [56784] (14 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 404483Family c.108.1.5: Probable phosphatase YrbI [69467] (1 protein)
    the insertion subdomain is a beta-hairpin involved into tetramerisation
  6. 404484Protein Probable phosphatase YrbI [69468] (1 species)
  7. 404485Species Haemophilus influenzae, HI1679 [TaxId:727] [69469] (2 PDB entries)
  8. 404493Domain d1k1eh_: 1k1e H: [68002]

Details for d1k1eh_

PDB Entry: 1k1e (more details), 1.67 Å

PDB Description: Structure Of the cobalt-bound form of the deoxy-D-mannose-octulosonate 8-phosphate phosphatase (YrbI) From Haemophilus Influenzae (HI1679)

SCOP Domain Sequences for d1k1eh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1eh_ c.108.1.5 (H:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679}
qklenikfvitdvdgvltdgqlhydangeaiksfhvrdglgikmlmdadiqvavlsgrds
pilrrriadlgiklfflgkleketacfdlmkqagvtaeqtayigddsvdlpafaacgtsf
avadapiyvknavdhvlsthggkgafremsdmilqaqgkssvfdtaqgflk

SCOP Domain Coordinates for d1k1eh_:

Click to download the PDB-style file with coordinates for d1k1eh_.
(The format of our PDB-style files is described here.)

Timeline for d1k1eh_: