![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein) |
![]() | Protein S-adenosylhomocystein hydrolase [52301] (3 species) contains additional secondary structures disguising the superfamily fold |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries) |
![]() | Domain d1k0ud2: 1k0u D:2-189,D:353-431 [67977] Other proteins in same PDB: d1k0ua1, d1k0ub1, d1k0uc1, d1k0ud1, d1k0ue1, d1k0uf1, d1k0ug1, d1k0uh1 complexed with dea, nad |
PDB Entry: 1k0u (more details), 3 Å
SCOPe Domain Sequences for d1k0ud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ud2 c.23.12.3 (D:2-189,D:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]} dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv kltkltekqaqylgmpingpfkpdhyry
Timeline for d1k0ud2: