Lineage for d1k0ud2 (1k0u D:2-189,D:353-431)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103344Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2103456Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 2103457Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 2103464Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
  8. 2103472Domain d1k0ud2: 1k0u D:2-189,D:353-431 [67977]
    Other proteins in same PDB: d1k0ua1, d1k0ub1, d1k0uc1, d1k0ud1, d1k0ue1, d1k0uf1, d1k0ug1, d1k0uh1
    complexed with dea, nad

Details for d1k0ud2

PDB Entry: 1k0u (more details), 3 Å

PDB Description: Inhibition of S-adenosylhomocysteine Hydrolase by "acyclic sugar" Adenosine Analogue D-eritadenine
PDB Compounds: (D:) s-adenosyl-l-homocysteine hydrolase

SCOPe Domain Sequences for d1k0ud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ud2 c.23.12.3 (D:2-189,D:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOPe Domain Coordinates for d1k0ud2:

Click to download the PDB-style file with coordinates for d1k0ud2.
(The format of our PDB-style files is described here.)

Timeline for d1k0ud2: