Lineage for d1k0nb1 (1k0n B:92-241)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153069Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
  7. 153070Species Human (Homo sapiens) [TaxId:9606] [69034] (3 PDB entries)
  8. 153076Domain d1k0nb1: 1k0n B:92-241 [67955]
    Other proteins in same PDB: d1k0na2, d1k0nb2

Details for d1k0nb1

PDB Entry: 1k0n (more details), 1.8 Å

PDB Description: chloride intracellular channel 1 (clic1) complexed with glutathione

SCOP Domain Sequences for d1k0nb1:

Sequence, based on SEQRES records: (download)

>d1k0nb1 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records): (download)

>d1k0nb1 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsprkfl
dgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddee
ielayeqvakalk

SCOP Domain Coordinates for d1k0nb1:

Click to download the PDB-style file with coordinates for d1k0nb1.
(The format of our PDB-style files is described here.)

Timeline for d1k0nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0nb2