Lineage for d1k0na1 (1k0n A:92-241)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089235Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 1089236Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries)
  8. 1089243Domain d1k0na1: 1k0n A:92-241 [67953]
    Other proteins in same PDB: d1k0na2, d1k0nb2
    complexed with gsh

Details for d1k0na1

PDB Entry: 1k0n (more details), 1.8 Å

PDB Description: chloride intracellular channel 1 (clic1) complexed with glutathione
PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1k0na1:

Sequence, based on SEQRES records: (download)

>d1k0na1 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records): (download)

>d1k0na1 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefas
tcpddeeielayeqvakalk

SCOPe Domain Coordinates for d1k0na1:

Click to download the PDB-style file with coordinates for d1k0na1.
(The format of our PDB-style files is described here.)

Timeline for d1k0na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0na2