Lineage for d1k0ma2 (1k0m A:6-91)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181003Protein Chloride intracellular channel 1 (clic1) [69514] (1 species)
  7. 181004Species Human (Homo sapiens) [TaxId:9606] [69515] (3 PDB entries)
  8. 181005Domain d1k0ma2: 1k0m A:6-91 [67950]
    Other proteins in same PDB: d1k0ma1, d1k0mb1

Details for d1k0ma2

PDB Entry: 1k0m (more details), 1.4 Å

PDB Description: crystal structure of a soluble monomeric form of clic1 at 1.4 angstroms

SCOP Domain Sequences for d1k0ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp
fllygtevhtdtnkieefleavlcpp

SCOP Domain Coordinates for d1k0ma2:

Click to download the PDB-style file with coordinates for d1k0ma2.
(The format of our PDB-style files is described here.)

Timeline for d1k0ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0ma1