| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) ![]() |
| Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins) |
| Protein Chloride intracellular channel 1 (clic1) [69514] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69515] (3 PDB entries) |
| Domain d1k0ma2: 1k0m A:6-91 [67950] Other proteins in same PDB: d1k0ma1, d1k0mb1 |
PDB Entry: 1k0m (more details), 1.4 Å
SCOP Domain Sequences for d1k0ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp
fllygtevhtdtnkieefleavlcpp
Timeline for d1k0ma2: