Lineage for d1k0la2 (1k0l A:174-275)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180483Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2180484Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2180554Family d.16.1.2: PHBH-like [54378] (4 proteins)
  6. 2180563Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)
  7. 2180564Species Pseudomonas aeruginosa [TaxId:287] [54381] (18 PDB entries)
  8. 2180571Domain d1k0la2: 1k0l A:174-275 [67948]
    Other proteins in same PDB: d1k0la1
    complexed with fad, so3, so4

Details for d1k0la2

PDB Entry: 1k0l (more details), 2 Å

PDB Description: pseudomonas aeruginosa phbh r220q free of p-ohb
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1k0la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0la2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa [TaxId: 287]}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsqyyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep

SCOPe Domain Coordinates for d1k0la2:

Click to download the PDB-style file with coordinates for d1k0la2.
(The format of our PDB-style files is described here.)

Timeline for d1k0la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0la1