![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.2: PHBH-like [54378] (4 proteins) |
![]() | Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [54381] (18 PDB entries) |
![]() | Domain d1k0la2: 1k0l A:174-275 [67948] Other proteins in same PDB: d1k0la1 complexed with fad, so3, so4 |
PDB Entry: 1k0l (more details), 2 Å
SCOPe Domain Sequences for d1k0la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0la2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa [TaxId: 287]} lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsqyyvqvplsekved wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
Timeline for d1k0la2: