Lineage for d1k0cb2 (1k0c B:100-200)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2485205Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species)
    similar to class phi enzymes
  7. 2485206Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries)
  8. 2485220Domain d1k0cb2: 1k0c B:100-200 [67925]
    Other proteins in same PDB: d1k0ca1, d1k0cb1, d1k0cc1, d1k0cd1
    complexed with gsh, gtb

Details for d1k0cb2

PDB Entry: 1k0c (more details), 2.5 Å

PDB Description: Ure2p in complex with S-p-nitrobenzylglutathione
PDB Compounds: (B:) ure2 protein

SCOPe Domain Sequences for d1k0cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0cb2 c.47.1.5 (B:100-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv
npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl

SCOPe Domain Coordinates for d1k0cb2:

Click to download the PDB-style file with coordinates for d1k0cb2.
(The format of our PDB-style files is described here.)

Timeline for d1k0cb2: