![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47329] (3 PDB entries) |
![]() | Domain d1jzqa1: 1jzq A:642-821 [67869] Other proteins in same PDB: d1jzqa2, d1jzqa3 complexed with ila, zn |
PDB Entry: 1jzq (more details), 3 Å
SCOP Domain Sequences for d1jzqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzqa1 a.27.1.1 (A:642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} yfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqrvtealeaydpt tsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftpfl aevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv
Timeline for d1jzqa1: