Lineage for d1jzqa1 (1jzq A:642-821)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96910Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
  4. 96911Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 96912Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins)
  6. 96920Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)
  7. 96925Species Thermus thermophilus [TaxId:274] [47329] (3 PDB entries)
  8. 96928Domain d1jzqa1: 1jzq A:642-821 [67869]
    Other proteins in same PDB: d1jzqa2, d1jzqa3

Details for d1jzqa1

PDB Entry: 1jzq (more details), 3 Å

PDB Description: Isoleucyl-tRNA synthetase Complexed with Isoleucyl-adenylate analogue

SCOP Domain Sequences for d1jzqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzqa1 a.27.1.1 (A:642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
yfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqrvtealeaydpt
tsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftpfl
aevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv

SCOP Domain Coordinates for d1jzqa1:

Click to download the PDB-style file with coordinates for d1jzqa1.
(The format of our PDB-style files is described here.)

Timeline for d1jzqa1: