Lineage for d1jzja_ (1jzj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770478Protein Azurin [49530] (6 species)
  7. 2770509Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
    Uniprot P00282
  8. 2770657Domain d1jzja_: 1jzj A: [67859]
    complexed with cu, dos, ime, los

Details for d1jzja_

PDB Entry: 1jzj (more details), 1.8 Å

PDB Description: pseudomonas aeruginosa azurin os(bpy)2(im)(his83)
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d1jzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzja_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d1jzja_:

Click to download the PDB-style file with coordinates for d1jzja_.
(The format of our PDB-style files is described here.)

Timeline for d1jzja_: