Lineage for d1jzja_ (1jzj A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106648Protein Azurin [49530] (6 species)
  7. 106677Species Pseudomonas aeruginosa [TaxId:287] [49533] (31 PDB entries)
  8. 106709Domain d1jzja_: 1jzj A: [67859]

Details for d1jzja_

PDB Entry: 1jzj (more details), 1.8 Å

PDB Description: pseudomonas aeruginosa azurin os(bpy)2(im)(his83)
PDB Compounds: (A:)

SCOP Domain Sequences for d1jzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzja_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1jzja_:

Click to download the PDB-style file with coordinates for d1jzja_.
(The format of our PDB-style files is described here.)

Timeline for d1jzja_: