Lineage for d1jz5b3 (1jz5 B:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774288Domain d1jz5b3: 1jz5 B:13-219 [67777]
    Other proteins in same PDB: d1jz5a1, d1jz5a2, d1jz5a4, d1jz5a5, d1jz5b1, d1jz5b2, d1jz5b4, d1jz5b5, d1jz5c1, d1jz5c2, d1jz5c4, d1jz5c5, d1jz5d1, d1jz5d2, d1jz5d4, d1jz5d5
    complexed with 149, dms, mg, na

Details for d1jz5b3

PDB Entry: 1jz5 (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1- on
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1jz5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz5b3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jz5b3:

Click to download the PDB-style file with coordinates for d1jz5b3.
(The format of our PDB-style files is described here.)

Timeline for d1jz5b3: