Lineage for d1jz4c5 (1jz4 C:334-625)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569297Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1569305Species Escherichia coli [TaxId:562] [51511] (41 PDB entries)
    Uniprot P00722
  8. 1569380Domain d1jz4c5: 1jz4 C:334-625 [67764]
    Other proteins in same PDB: d1jz4a1, d1jz4a2, d1jz4a3, d1jz4a4, d1jz4b1, d1jz4b2, d1jz4b3, d1jz4b4, d1jz4c1, d1jz4c2, d1jz4c3, d1jz4c4, d1jz4d1, d1jz4d2, d1jz4d3, d1jz4d4
    complexed with 2dg, dms, mg, na

Details for d1jz4c5

PDB Entry: 1jz4 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl-enzyme intermediate (low bis-tris)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jz4c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz4c5 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1jz4c5:

Click to download the PDB-style file with coordinates for d1jz4c5.
(The format of our PDB-style files is described here.)

Timeline for d1jz4c5: