| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
| Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
| Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
| Domain d1jz2c2: 1jz2 C:626-730 [67721] Other proteins in same PDB: d1jz2a3, d1jz2a4, d1jz2a5, d1jz2b3, d1jz2b4, d1jz2b5, d1jz2c3, d1jz2c4, d1jz2c5, d1jz2d3, d1jz2d4, d1jz2d5 complexed with 2fg, btb, dms, mg, na |
PDB Entry: 1jz2 (more details), 2.1 Å
SCOPe Domain Sequences for d1jz2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz2c2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1jz2c2:
View in 3DDomains from same chain: (mouse over for more information) d1jz2c1, d1jz2c3, d1jz2c4, d1jz2c5 |